Gotowa bibliografia na temat „Bacteriocins”
Utwórz poprawne odniesienie w stylach APA, MLA, Chicago, Harvard i wielu innych
Spis treści
Zobacz listy aktualnych artykułów, książek, rozpraw, streszczeń i innych źródeł naukowych na temat „Bacteriocins”.
Przycisk „Dodaj do bibliografii” jest dostępny obok każdej pracy w bibliografii. Użyj go – a my automatycznie utworzymy odniesienie bibliograficzne do wybranej pracy w stylu cytowania, którego potrzebujesz: APA, MLA, Harvard, Chicago, Vancouver itp.
Możesz również pobrać pełny tekst publikacji naukowej w formacie „.pdf” i przeczytać adnotację do pracy online, jeśli odpowiednie parametry są dostępne w metadanych.
Artykuły w czasopismach na temat "Bacteriocins"
Joshi, Khyati, Pravir Kumar i Rashmi Kataria. "Bacteriocins as promising alternatives to conventional antimicrobial agents". Research Journal of Biotechnology 18, nr 4 (15.03.2023): 133–40. http://dx.doi.org/10.25303/1804rjbt1330140.
Pełny tekst źródłaOUMER, A., S. GARDE, P. GAYA, M. MEDINA i M. NUÑEZ. "The Effects of Cultivating Lactic Starter Cultures with Bacteriocin-Producing Lactic Acid Bacteria". Journal of Food Protection 64, nr 1 (1.01.2001): 81–86. http://dx.doi.org/10.4315/0362-028x-64.1.81.
Pełny tekst źródłaCintas, L. M., M. P. Casaus, C. Herranz, I. F. Nes i P. E. Hernández. "Review: Bacteriocins of Lactic Acid Bacteria". Food Science and Technology International 7, nr 4 (sierpień 2001): 281–305. http://dx.doi.org/10.1106/r8de-p6hu-clxp-5ryt.
Pełny tekst źródłaDrider, Djamel, Gunnar Fimland, Yann Héchard, Lynn M. McMullen i Hervé Prévost. "The Continuing Story of Class IIa Bacteriocins". Microbiology and Molecular Biology Reviews 70, nr 2 (czerwiec 2006): 564–82. http://dx.doi.org/10.1128/mmbr.00016-05.
Pełny tekst źródłaVogel, Verena, i Barbara Spellerberg. "Bacteriocin Production by Beta-Hemolytic Streptococci". Pathogens 10, nr 7 (9.07.2021): 867. http://dx.doi.org/10.3390/pathogens10070867.
Pełny tekst źródłaZhang, Tingting, Yu Zhang, Lin Li, Xiuqi Jiang, Zhuo Chen, Fan Zhao i Yanglei Yi. "Biosynthesis and Production of Class II Bacteriocins of Food-Associated Lactic Acid Bacteria". Fermentation 8, nr 5 (10.05.2022): 217. http://dx.doi.org/10.3390/fermentation8050217.
Pełny tekst źródłaTodorov, Svetoslav Dimitrov, Igor Popov, Richard Weeks i Michael Leonidas Chikindas. "Use of Bacteriocins and Bacteriocinogenic Beneficial Organisms in Food Products: Benefits, Challenges, Concerns". Foods 11, nr 19 (10.10.2022): 3145. http://dx.doi.org/10.3390/foods11193145.
Pełny tekst źródłaHassan, Mahreen Ul, Hina Nayab, Tayyab Ur Rehman, Mike P. Williamson, Khayam Ul Haq, Nuzhat Shafi i Farheen Shafique. "Characterisation of Bacteriocins Produced by Lactobacillus spp. Isolated from the Traditional Pakistani Yoghurt and Their Antimicrobial Activity against Common Foodborne Pathogens". BioMed Research International 2020 (12.09.2020): 1–10. http://dx.doi.org/10.1155/2020/8281623.
Pełny tekst źródłaTeber, Rabeb, i Shuichi Asakawa. "In Silico Screening of Bacteriocin Gene Clusters within a Set of Marine Bacillota Genomes". International Journal of Molecular Sciences 25, nr 5 (22.02.2024): 2566. http://dx.doi.org/10.3390/ijms25052566.
Pełny tekst źródłaZimina, Maria, Olga Babich, Alexander Prosekov, Stanislav Sukhikh, Svetlana Ivanova, Margarita Shevchenko i Svetlana Noskova. "Overview of Global Trends in Classification, Methods of Preparation and Application of Bacteriocins". Antibiotics 9, nr 9 (28.08.2020): 553. http://dx.doi.org/10.3390/antibiotics9090553.
Pełny tekst źródłaRozprawy doktorskie na temat "Bacteriocins"
Powell, Jillian Elizabeth. "Bacteriocins and bacteriocin producers present in kefir and kefir grains". Thesis, Stellenbosch : University of Stellenbosch, 2006. http://hdl.handle.net/10019.1/2140.
Pełny tekst źródłaKefir is a traditional fermented milk that is carbonated, has a sharp acidic taste, yeasty flavour and contains a low percentage alcohol (less than 2% (v/v)). The beverage is manufactured by fermenting milk with Kefir grains, comprised of microorganisms, polysaccharides and milk proteins. The microbial population of Kefir grains primarily include lactic acid bacteria (LAB), namely lactococci and lactobacilli, yeasts, Acetobacter and filamentous fungi. Kefir exhibits antimicrobial activity in vitro against some fungi, and Grampositive and Gram-negative bacteria. Although the exact cause of this inhibition in Kefir is not known, the ability of LAB to inhibit the growth of closely related bacteria is well known. This inhibition of pathogenic and spoilage microbes may be due to the production of organic acids, hydrogen peroxide, acetaldehyde, diacetyl, carbon dioxide or bacteriocins. Acid is not the only contributor to the antimicrobial activity of Kefir and Kefir grains, and bacteriocins may play a role in the inhibitory activity. The bacteriocin producer Lactobacillus plantarum ST8KF, isolated from Kefir and Kefir grains, produces a bacteriocin 3.5 kDa in size. The mode of activity of bacteriocin ST8KF (bacST8KF) is thought to be bacteriostatic in exponential cultures of Enterococcus faecalis E88, Lactobacillus casei LHS, Lactobacillus curvatus DF38, Lactobacillus sakei DSM 20017, Lactobacillus salivarius 241 and Listeria innocua F and LMG 13568. The peptide is sensitive to proteolytic enzymes and does not adsorb to the surface of the producer cell. The bacteriocin is stable between pH 2.0 and 10.0, and for 20 min at 121°C. Maximum bacteriocin activity was observed in modified MRS medium supplemented with glucose or saccharose, meat extract, KH2PO4, glycerol, thiamine or cyanocobalamin, or in modified MRS medium without tri-ammonium citrate. Maximum levels of adsorption of bacST8KF (80%) to Lb. casei LHS and Lb. sakei DSM 20017 were recorded. Adsorption (80%) of the bacteriocin to Lactobacillus paraplantarum ATCC 700211T and Streptococcus caprinus ATCC 700066, which are not sensitive to the bacteriocin was also recorded. Optimal adsorption to E. faecalis E88 was recorded at 25°C at pH 2.0, and to L. innocua LMG 13568 at 4°C, 10°C and 25°C at pH 6.0. Potassium ions, MgCl2, Tris, NH4- citrate, Na-acetate, Na2CO3, EDTA and SDS led to decreased adsorption to both sensitive strains, while NaCl and mercaptoethanol resulted decreased adsorption to E. faecalis E88, but not to L. innocua LMG 13568. Methanol resulted in lower levels of adsorption to L. innocua LMG 13568 but not to E. faecalis E88. Triton X-100 and Triton X-114 increased the adsorption of bacST8KF by 40%, and ethanol and chloroform had no effect on bacteriocin adsorption. The growth of Lb. plantarum ST8KF and L. innocua LMG 13568 in a mixed culture resulted in an increase of bacST8KF production. Cells treated with bacST8KF secreted DNA and galactosidase. As bacST8KF remains stable under a variety of conditions, the bacteriocin may have application, if awarded GRAS (generally regarded as safe) status, in various food products as a natural additive or preservative. The genes encoding bacteriocin production are located on a 3.9 kilo base (kb) plasmid. Curing of the plasmid resulted in a mutant strain of Lb. plantarum ST8KF, and the Lb. plantarum strains ST8KF(+) and ST8KF(-) differed with regards to antibiotic resistance and carbohydrate fermentation reactions. The wild type and the cured strain were incorporated into Kefir grains during mass cultivation. The survival of the bacST8KF sensitive Enterococcus mundtii ST4SA added to the milk during Kefir production using the enriched mass cultured grains was monitored using fluorescent in situ hybridization. Enterococcus mundtii ST4SA was present in higher numbers in the ST8KF(-) Kefir system when compared to the ST8KF(+) system. It can, therefore, be concluded that Lb. plantarum ST8KF(+) contributes to the antimicrobial activity of Kefir through the production of bacteriocin ST8KF.
Borges, Danielle Oliveira. "Efeito de Leuconostoc mesenteroides subsp. mesenteroides SJRP55 em creme fermentado /". São José do Rio Preto, 2017. http://hdl.handle.net/11449/152215.
Pełny tekst źródłaCoorientador: Sabrina Neves Casarotti
Banca: Neuza Jorge
Banca: Aline Teodoro de Paula
Resumo: As bactérias acidoláticas (BAL) são bastante utilizadas em processos fermentativos na indústria de laticínios, porém algumas delas agem não somente como fermentadoras, com a produção de ácidos orgânicos a partir dos carboidratos presentes, mas também podem produzir substâncias que colaboram para a segurança microbiológica do produto fermentado ou compostos benéficos à saude. Em estudos in vitro anteriores, foi constatado que Leuconostoc mesenteroides subsp. mesenteroides SJRP55 apresenta potencial probiótico e ação bacteriostática sobre bactérias patogênicas, como Listeria monocytogenes e Escherichia coli. Neste trabalho foi avaliado o efeito de Leuconostoc mesenteroides subsp. mesenteroides SJRP55 em creme fermentado, em co-cultura com outras BAL, e estudar as características físico-químicas e microbiológicas do creme, além de avaliar a capacidade de bioconservação pela produção de bacteriocinas, ácidos orgânicos e propriedade funcional pela produção de ácido linoleico conjugado (CLA) e pela atividade antioxidante por inibição de radicais livres. Foi utilizado creme de leite UHT homogeneizado padronizado em 20% de gordura e fermentado conforme quatro tratamentos: T1 - cultura mista de Lactococcus lactis subsp. lactis e Lc. lactis subsp. cremoris; T2 - cultura mista de Lc. lactis subsp. lactis e Lc. lactis subsp. cremoris + Listeria monocytogenes ATCC 15313; T3 - Cultura mista de Lc. lactis subsp. lactis e Lc. lactis subsp. cremoris + Ln. mesenteroides subsp. mesenteroides...
Abstract: Lactic acid bacteria (LAB) are widely used in fermentation processes in the dairy industry, however some of them act not only as starters, with the production of organic acids from the carbohydrates, but they can also produce substances that contribute to the microbiological safety of the fermented product or produce health benefic compounds. In previous in vitro studies, it was found that Leuconostoc mesenteroides subsp. mesenteroides SJRP55 presents probiotic potential and bacteriostatic action on pathogenic bacteria, such as Listeria monocytogenes and Escherichia coli. In this study it was evaluated the effect of Leuconostoc mesenteroides subsp. mesenteroides SJRP55 in fermented cream, in co-cultivation with other BAL, and to study the physicochemical and microbiological characteristics of the cream, besides evaluating the capacity of bioconservation by the production of bacteriocins, organic acids and functional property by the production of conjugated linoleic acid (CLA) and antioxidant activity through the inhibition of free radicals. UHT milk cream standardized at 20% fat was fermented according to four treatments: T1 - Mixed culture of Lactococcus lactis subsp. lactis and Lc. lactis subsp. cremoris, T2 - Mixed culture of Lactococcus lactis subsp. lactis and Lc. lactis subsp. cremoris + Listeria monocytogenes ATCC 15313, T3 - Mixed culture of Lactococcus lactis subsp. lactis and Lc. lactis subsp. cremoris + Ln. mesenteroides subsp. mesenteroides SJRP55, and T4 - Mixed ...
Mestre
Tait, Karen. "Control of biofilm formation : bacteriocins, bacteriophage and biocides". Thesis, University of Edinburgh, 2000. http://hdl.handle.net/1842/13068.
Pełny tekst źródłaReid, Carole L. "Bioluminescence in the study of antimicrobials produced by lactic acid bacteria". Thesis, University of Nottingham, 1996. http://ethos.bl.uk/OrderDetails.do?uin=uk.bl.ethos.321396.
Pełny tekst źródłaVan, Reenen Carol A. (Carol Ann). "Characterization of bacteriocin 423 produced by Lactobacillus pentosus". Thesis, Stellenbosch : Stellenbosch University, 2000. http://hdl.handle.net/10019.1/51652.
Pełny tekst źródłaENGLISH ABSTRACT: Worldwide, bacteriocins, particularly those produced by food-related lactic acid bacteria, are receiving attention due to the possible use of these peptides as natural preservatives in food, replacing potentially harmful chemical preservatives. Bacteriocins are ribosomally synthesized proteins or peptides that inhibit closely related microorganisms. Most bacteriocins produced by lactic acid bacteria are small, heat resistant peptides that inhibit other Gram-positive bacteria, including food-borne pathogens such as Listeria monocytogenes, Bacillus cereus, Clostridium perfringens and Staphylococcus aureus, but do not inhibit Gram-negative bacteria, molds or fungi. Bacteriocins are produced as inactive prepeptides that become active after the N-terminal leader peptide is cleaved off. Small heat resistant bacteriocins are either lantibiotics (Class I), containing unusual posttranslationally modified amino acids, or peptides that are non-Ianthionines (Class II). The Class II bacteriocins are further divided into four different groups: Class lIa, the anti-listerial bacteriocins containing the YGNGV consensus sequence in the N-terminal of the protein, Class lib, bacteriocins consisting of two peptides, Class IIc, bacteriocins that are secreted via the sec pathway, and Class lid, bacteriocins that do not belong in the previous three subgroups. A bacteriocin producing lactic acid bacterium was isolated in our laboratory from traditionally home fermented South African sorghum beer. The producing bacterium was found to be a facultative heterofermentative Lactobacillus sp. and was identified as Lactobacillus plantarum or Lactobacillus pentosus by using the API 50 CHL carbohydrate fermentation system and numerical analysis of total soluble cell protein patterns. RAPD-PCR analysis identified the strain as L. plantarum, but 16S rRNA sequencing confirmed its identification as L. pentosus. The bacteriocin, first designated plantaricin 423 and later bacteriocin 423, was identified as a Class lIa small heat resistant anti-listerial bacteriocin containing the YGNGV consensus motif. Bacteriocin 423 inhibited a variety of Gram-positive bacteria, including Lactobacillus spp., Leuconostoc spp., Oenococcus oeni, Pediococcus spp., Enterococcus spp., Propionibacterium spp., Staphylococcus spp., Bacillus spp., Clostridium spp. and Listeria spp. The bacteriocin was inactivated by proteolytic enzymes and active over a wide pH range (pH 1-10). Bacteriocin 423 lost 50 % of its activity after autoclaving for 15 min at 121°C, but was not affected by lesser heat treatments. Bacteriocin production was increased by optimizing the growth medium, which consisted of glucose, tryptone, yeast extract, potassium phosphate, sodium acetate, ammonium citrate, manganese sulphate, Tween 80 and casamino acids. The bacteriocin was found to be plasmid-encoded. Genetic analysis of the bacteriocin operon indicated a high percentage of homology to the operon of another Class lIa bacteriocin, pediocin PA-1, although the structural genes of the two bacteriocins were markedly different. The structural gene of bacteriocin 423 was amplified by PCR and cloned into a yeastJE. coli vector between the ADH1 promoter and terminator sequences and fused in-frame to the MFa1 secretion signal sequence. Saccharomyces cerevisiae transformed with this plasmid expressed the bacteriocin. The sequence of prebacteriocin 423 (MMKKIEKL TEKEMANIIGGKYYGNGVTCGKHSCSVN WGOAFSCSVSHLANFGHGKC) is similar, but not identical to any other reported Class lIa anti-listeria I peptide.
AFRIKAANSE OPSOMMING: Bakteriosiene, veral dié wat deur melksuurbakterieë geproduseer word, wek belangstelling as gevolg van die moontlike gebruik van hierdie natuurlike antimikrobiese proteiëne as preserveermiddels in voedselprodukte, in plaas van potensieël gevaarlike chemiese preserveermiddels. Bakteriosiene is ribosomaal-vervaardigde proteiëne wat naverwante bakterieë inhibeer. Die meeste bakteriosiene wat deur melksuurbakterieë geproduseer word, is klein en hittebestand. Hierdie bakteriosiene inhibeer ander Gram-positiewe bakterieë, insluitend patogene soos Listeria monocytogenes, Bacillus cereus, Clostridium perfringens en Staphylococcus aureus, maar inhibeer nie Gram-negatiewe bakterieë, giste of swamme nie. Bakteriosiene word as onaktiewe prepeptiede geproduseer, wat ge-aktiveer word wanneer die N-terminale leierpeptied afgesplits word. Klein hittebestande bakteriosiene is óf lantibiotika (Klas I), met ongewone aminosure, óf normale peptiede (Klas II). Laasgenoemde klas kan verder in vier groepe verdeel word. Klas lIa is anti-listeriese bakteriosiene met fn YGNGVaminosuurvolgorde in die N-terminale kant van die peptied. Klas lib sluit in bakteriosiene wat uit twee peptiede bestaan. Klas lie is sec-afhanklike bakteriosiene, en Klas lid sluit in al die bakteriosiene wat nie in die eerste drie groepe geklassifiseer kan word nie. 'n Bakteriosien-produserende melksuurbakterie is uit tradisionele tuisgefermenteerde Suid- Afrikaanse sorghumbier geïsoleer. Die bakterie is as 'n fakultatief heterofermentatiewe Lactobacillus sp. geïdentifiseer. Die bakterie is verder as 'n Lactobacillus plantarum of Lactobacillus pentosus geïdentifiseer deur middel van die API 50 CHL-koolhidraat fermentasiesisteem en numeriese analiese van totale oplosbare selproteiënprofiele. Met RAPD-PCR analiese is die organisme as L. plantarum geïdentifiseer, maar 168 rRNA nukleotiedopeenvolging het die identiteit van die organisme as L. pentosus bevestig. Bakteriosien 423, aanvanklik geklassifiseer as plantaricin 423, is fn klein Klas lIa, hittebestande en anti-listeriese bakteriosien met die YGNGV motief, wat verskeie Grampositiewe bakterieë inhibeer. Bakteriosien 423 het verskeie Gram-positiewe organismes geïnhibeer, onder andere Lactobacillus spp., Leuconostoc spp., Oenococcus oeni, Pediococcus spp., Enterococcus spp., Propionibacterium spp., Staphylococcus spp., Bacillus spp., Clostridium spp., en Listeria spp. Proteolitiese ensieme inaktiveer die bakteriosien. Die peptied was oor 'n pH reeks van 1-10 aktief. Outoklavering vir 15 min by 121°C het die aktiwiteit van die peptied halveer, maar die bakteriosien is nie geïnaktiveer met ander hittebehandelings nie. Produksie van die bakteriosien is verhoog deur die groeimedium te optimiseer. Die groeimedium het bestaan uit glukose, triptoon, gisekstrak, kaliumfosfaat, natriumasetaat, ammoniumsitraat, mangaansulfaat, Tween 80 en casaminosure. Die bakteriosien se genetiese determinante is op In plasmied gesetel. Genetiese analiese van die bakteriosien operon het 'n hoë homologie met In ander Klas lIa bakteriosien, pediocin PA-1, getoon, maar die strukturele gene van die twee bakteriosiene verskil merkbaar. Die strukturele geen van bakteriosien 423 is met PKR ge-amplifiseer en in 'n gistE. coli-vektor tussen die ADH1 promotor- en termineerderopeenvolgings, in leesraam met die MFa1 sekresiesein, gekloneer. Saccharomyces cerevisiae wat met hierdie plasmied getransformeer is, het bakteriosien 423 uitgedruk. Die aminosuurvolgorde van prebakteriosien 423 (MMKKIEKL TEKEMANIIGGKYYGNGVTCGKHSCSVNWGOAFSCSVSHLANFGHGKC) is verwant aan, maar nie identies aan, ander Klas lIa anti-listeriese peptiede.
Xue, Junfeng. "Genes involved in carbon source utilization and pediocin AcH resistance in Listeria". Laramie, Wyo. : University of Wyoming, 2007. http://proquest.umi.com/pqdweb?did=1456284371&sid=2&Fmt=2&clientId=18949&RQT=309&VName=PQD.
Pełny tekst źródłaAlves, Fernanda Cristina Bérgamo. "Ação antibacteriana de associações de antimicrobianos : nisina, óleos essenciais e compostos majotitários /". Botucatu, 2014. http://hdl.handle.net/11449/108870.
Pełny tekst źródłaBanca: Maria de Lourdes Ribeiro da Cunha
Banca: Rosemeire Cristina Lianhri Rodrigues Pietro
Resumo: A pesquisa por novas drogas antimicrobianas tem aumentado, seja na indústria farmacêutica e também na indústria de alimentos. Isso acontece devido ao aumento no número de bactérias resistentes aos antimicrobianos, e a busca por conservantes alimentares que possibilitem o aumento na vida de prateleira dos alimentos. O interesse por alimentos mais saudáveis, especialmente aqueles sem adição ou com quantidades reduzidas de aditivos químicos, vem aumentando constantemente. Os produtos naturais, especialmente os de origem microbiana e de espécies vegetais são considerados fontes importantes para o desenvolvimento de novos antimicrobianos. O trabalho teve como objetivo avaliar a ação antibacteriana de óleos essenciais de plantas, seus compostos majoritários, a ação antibacteriana da nisina (bacteriocina produzida por Lactococcus lactis) e a ação antibacteriana da combinação desses compostos majoritários com a nisina em meio de cultura e no leite. Inicialmente foi avaliado o potencial antibacteriano com a determinação da concentração inibitória mínima (CIM) dos óleos essenciais de orégano (Origanum vulgare), tomilho (Tymus vulgaris), cravo da índia (Syzygium aromaticum) e canela (Cinnamomun zeylanicum) e respectivos compostos majoritários carvacrol, timol, eugenol e cinamaldeído, e da nisina sobre cepas padrões ATCC de bactérias de importância na área de alimentos: Staphylococcus aureus ATCC 25923, Escherichia coli O157 ATCC 43895, Salmonella Enteritidis ATCC 13076, Pseudomonas aeruginosa ATCC 27853, Enterococcus faecalis ATCC 10100, Listeria monocytogenes ATCC 15313, Aeromonas hydrophila ATCC 7966 e Lactobacillus rhamnosus ATCC 9595 utilizando a metodologia da microdiluição em meio de Mueller Hinton Caldo (MHC). Em alguns casos a atividade inibidora dos óleos essenciais foi maior que a atividade do seu respectivo composto isolado, e em outros a atividade inibidora do composto isolado foi maior que ...
Abstract: The research for new antimicrobial drugs has increased in a pharmaceutical industry as well as in the food industry. This happens due to the increase in the number of bacteria resistant to antimicrobial agents, and the search for food preservatives which make possible the increase in the shelf life of foods. The interest in healthier foods, especially those without addition or with reduced amounts of chemical additives is increasing constantly. The natural products, especially of microbial origin and plant species are considered important sources for the development of new antimicrobial. This study purpose to evaluate the antibacterial activity of essential oils from plants, their major compounds, the antibacterial action of nisin (bacteriocin produced by Lactococcus lactis) and the antibacterial activity of the combination of these major compounds with nisin in culture medium and in milk. First was evaluated antimicrobial activity with determination of minimum inhibitory concentration (MIC) of the essential oils of oregano (Origanum vulgare), thyme (Tymus vulgaris), clove (Syzygium aromaticum) and cinnamon (Cinnamomun zeylanicum) and their major compounds carvacrol , thymol, eugenol and cinnamaldehyde, and nisin on ATCC strains of bacteria of importance in the food industry: Staphylococcus aureus ATCC 25923, Escherichia coli O157 ATCC 43895, Salmonella Enteritidis ATCC 13076, Pseudomonas aeruginosa ATCC 27853, Enterococcus faecalis ATCC 10100, Listeria monocytogenes ATCC 15313, Aeromonas hydrophila ATCC 7966 and Lactobacillus rhamnosus ATCC 9595 using the microdilution method in Mueller Hinton Broth medium (MHC). In some cases the inhibitory activity of essential oils has been higher than the activity of the respective isolated compound, and in others the inhibitory activity of the compound isolate was greater than that of the respective essential oils, whereas nisin was active against Gram-positive bacteria and a lower inhibitory ...
Mestre
Bodley, Mark David. "Application of bacteriocins in the preservation of fruit juice". Thesis, Nelson Mandela Metropolitan University, 2015. http://hdl.handle.net/10948/d1020188.
Pełny tekst źródłaHale, John D. F., i n/a. "Small bacteriocins produced by Streptococcus mutans and Streptococcus sanguis". University of Otago. Department of Microbiology & Immunology, 2006. http://adt.otago.ac.nz./public/adt-NZDU20060905.144149.
Pełny tekst źródłaHatziioanou, Diane. "Discovery and analysis of novel bacteriocins from gut bacteria". Thesis, University of East Anglia, 2011. http://ethos.bl.uk/OrderDetails.do?uin=uk.bl.ethos.539358.
Pełny tekst źródłaKsiążki na temat "Bacteriocins"
Riley, Margaret A., i Milind A. Chavan, red. Bacteriocins. Berlin, Heidelberg: Springer Berlin Heidelberg, 2007. http://dx.doi.org/10.1007/978-3-540-36604-1.
Pełny tekst źródłaGu, Qing. Bacteriocins. Singapore: Springer Nature Singapore, 2023. http://dx.doi.org/10.1007/978-981-99-2661-9.
Pełny tekst źródłaJames, Richard, Claude Lazdunski i Franc Pattus, red. Bacteriocins, Microcins and Lantibiotics. Berlin, Heidelberg: Springer Berlin Heidelberg, 1992. http://dx.doi.org/10.1007/978-3-642-76974-0.
Pełny tekst źródła1947-, James Richard, Lazdunski Claude, Pattus Franc i NATO Advanced Research Workshop on Bacterial Plasmid-Coded Toxins: Bacteriocins, microcins, and lantibiotics (1991 : Bandol, France), red. Bacteriocins, microcins and lantibiotics. Berlin: Springer-Verlag, 1992.
Znajdź pełny tekst źródłaRasool, Sheikh Ajaz. Bacteriocins: The protein antibiotics. Pakistan: (s.n.), 1992.
Znajdź pełny tekst źródłaDe Vuyst, Luc, i Erick J. Vandamme, red. Bacteriocins of Lactic Acid Bacteria. Boston, MA: Springer US, 1994. http://dx.doi.org/10.1007/978-1-4615-2668-1.
Pełny tekst źródłaG, Hoover Dallas, i Steenson Larry R, red. Bacteriocins of lactic acid bacteria. San Diego: Academic Press, 1993.
Znajdź pełny tekst źródłade, Vuyst Luc, i Vandamme Erick J. 1943-, red. Bacteriocins of lactic acid bacteria: Microbiology, genetics, and applications. London: Blackie Academic & Professional, 1994.
Znajdź pełny tekst źródłaCahill, Sarah Marie. The application of polymer gels in the development of a delivery system for the bacteriocin nisin. Dublin: University College Dublin, 1998.
Znajdź pełny tekst źródłaReeves, Peter. Bacteriocins. Springer London, Limited, 2012.
Znajdź pełny tekst źródłaCzęści książek na temat "Bacteriocins"
Gálvez, Antonio, Rosario Lucas, Hikmate Abriouel, María José Grande Burgos i Rubén Pérez Pulido. "Bacteriocins". W Decontamination of Fresh and Minimally Processed Produce, 317–32. Oxford, UK: Wiley-Blackwell, 2012. http://dx.doi.org/10.1002/9781118229187.ch18.
Pełny tekst źródłaRiley, Margaret A., i Milind A. Chavan. "Introduction". W Bacteriocins, 1–3. Berlin, Heidelberg: Springer Berlin Heidelberg, 2007. http://dx.doi.org/10.1007/978-3-540-36604-1_1.
Pełny tekst źródłaGordon, David M., Elizabeth Oliver i Jane Littlefield-Wyer. "The Diversity of Bacteriocins in Gram-Negative Bacteria". W Bacteriocins, 5–18. Berlin, Heidelberg: Springer Berlin Heidelberg, 2007. http://dx.doi.org/10.1007/978-3-540-36604-1_2.
Pełny tekst źródłaChavan, Milind A., i Margaret A. Riley. "Molecular Evolution of Bacteriocins in Gram-Negative Bacteria". W Bacteriocins, 19–43. Berlin, Heidelberg: Springer Berlin Heidelberg, 2007. http://dx.doi.org/10.1007/978-3-540-36604-1_3.
Pełny tekst źródłaHeng, Nicholas C. K., Philip A. Wescombe, Jeremy P. Burton, Ralph W. Jack i John R. Tagg. "The Diversity of Bacteriocins in Gram-Positive Bacteria". W Bacteriocins, 45–92. Berlin, Heidelberg: Springer Berlin Heidelberg, 2007. http://dx.doi.org/10.1007/978-3-540-36604-1_4.
Pełny tekst źródłaShand, Richard F., i Kathryn J. Leyva. "Peptide and Protein Antibiotics from the Domain Archaea: Halocins and Sulfolobicins". W Bacteriocins, 93–109. Berlin, Heidelberg: Springer Berlin Heidelberg, 2007. http://dx.doi.org/10.1007/978-3-540-36604-1_5.
Pełny tekst źródłaKerr, Benjamin. "The Ecological and Evolutionary Dynamics of Model Bacteriocin Communities". W Bacteriocins, 111–34. Berlin, Heidelberg: Springer Berlin Heidelberg, 2007. http://dx.doi.org/10.1007/978-3-540-36604-1_6.
Pełny tekst źródłaGillor, Osnat. "Bacteriocins' Role in Bacterial Communication". W Bacteriocins, 135–45. Berlin, Heidelberg: Springer Berlin Heidelberg, 2007. http://dx.doi.org/10.1007/978-3-540-36604-1_7.
Pełny tekst źródłaGu, Qing. "Human Health and Nutrition". W Bacteriocins, 107–26. Singapore: Springer Nature Singapore, 2023. http://dx.doi.org/10.1007/978-981-99-2661-9_6.
Pełny tekst źródłaGu, Qing. "Bacteriocinogenic Lactic Acid Bacteria and Antibacterial Mechanisms". W Bacteriocins, 39–61. Singapore: Springer Nature Singapore, 2023. http://dx.doi.org/10.1007/978-981-99-2661-9_3.
Pełny tekst źródłaStreszczenia konferencji na temat "Bacteriocins"
Lawalata, Helen Joan, Jovialine A. Rungkat, Wiesye Maya S. Nangoy, Anita C. C. Tengker i Nova G. H. Grees. "Bacteriocin Activity of Lactic Acid Bacteria from Ripe Tome-Tome Fruit (Flacourtia Inermis) Material". W Unima International Conference on Science and Technology 2022. Switzerland: Trans Tech Publications Ltd, 2023. http://dx.doi.org/10.4028/p-9grrk3.
Pełny tekst źródłaKalkan, Selin, Emel Ünal i Zerrin Erginkaya. "Comparison of Anti-Listerial Effect Spectrum of Bacteriocins". W Proceedings of the International Conference on Antimicrobial Research (ICAR2010). WORLD SCIENTIFIC, 2011. http://dx.doi.org/10.1142/9789814354868_0079.
Pełny tekst źródłaLiu, Shanna, i Zhijiang Zhou. "Natural Preservatives-Research Progress in Class II a Bacteriocins". W 2010 4th International Conference on Bioinformatics and Biomedical Engineering (iCBBE). IEEE, 2010. http://dx.doi.org/10.1109/icbbe.2010.5516456.
Pełny tekst źródłaMaia, Luciana Furlaneto, Mayara Baptistucci Ogaki i Márcia Cristina Furlaneto. "Genotypic Characterization of Bacteriocins in Enterococcal Isolates of Different Sources". W XII Latin American Congress on Food Microbiology and Hygiene. São Paulo: Editora Edgard Blücher, 2014. http://dx.doi.org/10.5151/foodsci-microal-003.
Pełny tekst źródłaKhromova, Natalya, Victor Panfilov, Ekaterina Marinicheva, Julia Epishkina i Irina Shakir. "A STUDY ON INDUSTRIAL STRAINS OF LACTIC ACID BACTERIA PRODUCING BACTERIOCINS". W 20th International Multidisciplinary Scientific GeoConference Proceedings SGEM 2020. STEF92 Technology, 2020. http://dx.doi.org/10.5593/sgem2020/6.1/s25.020.
Pełny tekst źródłaSuryani, Lilis, i Muhammad Kurniawan. "The effect of temperature and incubation time of bacteriocins produced by lactobacillus isolates growol against Salmonella typhi in vitro". W 12TH INTERNATIONAL SEMINAR ON NEW PARADIGM AND INNOVATION ON NATURAL SCIENCES AND ITS APPLICATIONS (12TH ISNPINSA): Contribution of Science and Technology in the Changing World. AIP Publishing, 2024. http://dx.doi.org/10.1063/5.0218072.
Pełny tekst źródłaMulyawati, Alifia Issabella, Tri Ardyati i Yoga Dwi Jatmiko. "Partial purification and characterization of bacteriocins from Lactobacillus plantarum SB7 and Bacillus amyloliquefaciens BC9 isolated from fermented Sumbawa mare’s milk as food preservative candidates". W INTERNATIONAL CONFERENCE ON BIOLOGY AND APPLIED SCIENCE (ICOBAS). AIP Publishing, 2019. http://dx.doi.org/10.1063/1.5115747.
Pełny tekst źródłaKüçük, Çiğdem, i Merih Kivanç. "Bacteriocin production by bean root bacteria". W Proceedings of the III International Conference on Environmental, Industrial and Applied Microbiology (BioMicroWorld2009). WORLD SCIENTIFIC, 2010. http://dx.doi.org/10.1142/9789814322119_0124.
Pełny tekst źródłaCONTESSA, C. R., N. B. SOUZA, G. B. GONÇALO, L. ALMEIDA, A. P. MANERA i C. C. MORAES. "ESTABILIDADE TÉRMICA DE BACTERIOCINA PRODUZIDA POR Lactobacillus sakei". W Congresso Brasileiro de Engenharia Química em Iniciação Científica. São Paulo: Editora Blucher, 2017. http://dx.doi.org/10.5151/chemeng-cobeqic2017-019.
Pełny tekst źródłaJie, Lin-Xia, Hui Liu, Hong-Xing Zhang i Yuan-Hong Xie. "Optimization of Bacteriocin Production by Lactobacillus Plantarum LF1". W 2015 International Conference on Medicine and Biopharmaceutical. WORLD SCIENTIFIC, 2016. http://dx.doi.org/10.1142/9789814719810_0156.
Pełny tekst źródłaRaporty organizacyjne na temat "Bacteriocins"
Barefoot, Susan, Benjamin Juven, Thomas Hughes, Avraham Lalazar, A. B. Bodine, Yitzhak Ittah i Bonita Glatz. Characterization of Bacteriocins Produced by Food Bioprocessing Propionobacteria. United States Department of Agriculture, sierpień 1992. http://dx.doi.org/10.32747/1992.7561061.bard.
Pełny tekst źródłaMontville, Thomas J., i Roni Shapira. Molecular Engineering of Pediocin A to Establish Structure/Function Relationships for Mechanistic Control of Foodborne Pathogens. United States Department of Agriculture, sierpień 1993. http://dx.doi.org/10.32747/1993.7568088.bard.
Pełny tekst źródłaBarefoot, Susan F., Bonita A. Glatz, Nathan Gollop i Thomas A. Hughes. Bacteriocin Markers for Propionibacteria Gene Transfer Systems. United States Department of Agriculture, czerwiec 2000. http://dx.doi.org/10.32747/2000.7573993.bard.
Pełny tekst źródłaStote, Robert E. Protocol for Initial Purification of Bacteriocin. Fort Belvoir, VA: Defense Technical Information Center, październik 2015. http://dx.doi.org/10.21236/ada627577.
Pełny tekst źródłaWeinberg, Zwi G., Richard E. Muck, Nathan Gollop, Gilad Ashbell, Paul J. Weimer i Limin Kung, Jr. effect of lactic acid bacteria silage inoculants on the ruminal ecosystem, fiber digestibility and animal performance. United States Department of Agriculture, wrzesień 2003. http://dx.doi.org/10.32747/2003.7587222.bard.
Pełny tekst źródłaSikes, Anthony, Wayne Muller i Claire Lee. Optimization of Fermentation Conditions for the Production of Bacteriocin Fermentate"". Fort Belvoir, VA: Defense Technical Information Center, marzec 2015. http://dx.doi.org/10.21236/ada614142.
Pełny tekst źródłaCytryn, Eddie, Mark R. Liles i Omer Frenkel. Mining multidrug-resistant desert soil bacteria for biocontrol activity and biologically-active compounds. United States Department of Agriculture, styczeń 2014. http://dx.doi.org/10.32747/2014.7598174.bard.
Pełny tekst źródła